Lineage for d4l3qa2 (4l3q A:219-460)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885061Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)
  8. 2885254Domain d4l3qa2: 4l3q A:219-460 [224553]
    Other proteins in same PDB: d4l3qa3
    automated match to d1bdga2
    complexed with 926, glc

Details for d4l3qa2

PDB Entry: 4l3q (more details), 2.7 Å

PDB Description: crystal structure of glucokinase-activator complex
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4l3qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l3qa2 c.55.1.0 (A:219-460) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
ka

SCOPe Domain Coordinates for d4l3qa2:

Click to download the PDB-style file with coordinates for d4l3qa2.
(The format of our PDB-style files is described here.)

Timeline for d4l3qa2: