SCOPe 2.03: Domain d4l06f_: 4l06 F:

Lineage for d4l06f_ (4l06 F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189131] (7 PDB entries)

8. Domain d4l06f_: 4l06 F: [224544]
   automated match to d3inmb_
   complexed with akg, ca, nap; mutant

Details for d4l06f_

PDB Entry: 4l06, 2.28 Å

PDB Description: crystal structure analysis of human idh1 mutants in complex with nadp+ and ca2+/alpha-ketoglutarate

PDB Compounds: (F:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d4l06f_:

Sequence; same for both SEQRES and ATOM records:

>d4l06f_ c.77.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiigrhaygdqdratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

Timeline for d4l06f_:

• d4l06f_ is new in SCOPe 2.03-stable
  
• d4l06f_ appears in SCOPe 2.04
  
• d4l06f_ appears in the current release, SCOPe 2.08