| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) ![]() |
| Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
| Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48402] (65 PDB entries) |
| Domain d4kz0a3: 4kz0 A:546-725 [224531] Other proteins in same PDB: d4kz0a1, d4kz0a2, d4kz0a4 automated match to d1e8ya1 complexed with 1uj, so4 |
PDB Entry: 4kz0 (more details), 2.87 Å
SCOPe Domain Sequences for d4kz0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kz0a3 a.118.1.6 (A:546-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
empnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiva
ktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvq
avkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg
Timeline for d4kz0a3: