SCOP 1.61: Domain d1rama2: 1ram A:19-191

Lineage for d1rama2 (1ram A:19-191)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.5: p53-like transcription factors [49417] (1 family)

5. Family b.2.5.1: p53-like transcription factors [49418] (12 proteins)

6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49429] (4 PDB entries)

8. Domain d1rama2: 1ram A:19-191 [22452]
   Other proteins in same PDB: d1rama1, d1ramb1

Details for d1rama2

PDB Entry: 1ram, 2.7 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer

SCOP Domain Sequences for d1rama2:

Sequence; same for both SEQRES and ATOM records:

>d1rama2 b.2.5.1 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

Timeline for d1rama2:

• d1rama2 first appeared (with stable ids) in SCOP 1.55
  
• d1rama2 appears in SCOP 1.59
  
• d1rama2 appears in SCOP 1.63
  
• d1rama2 appears in the current release, SCOPe 2.08