Lineage for d4kvia_ (4kvi A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504493Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)
  6. 1504508Protein automated matches [190618] (1 species)
    not a true protein
  7. 1504509Species Aspergillus terreus [TaxId:33178] [187650] (11 PDB entries)
  8. 1504530Domain d4kvia_: 4kvi A: [224490]
    automated match to d2oa6d_
    complexed with 1sv, mg, pop

Details for d4kvia_

PDB Entry: 4kvi (more details), 2.15 Å

PDB Description: Crystal structure of Aspergillus terreus aristolochene synthase complexed with (4aS,7S)-4a-methyl-7-(prop-1-en-2-yl)-2,3,4,4a,5,6,7,8-octahydroquinolin-1-ium
PDB Compounds: (A:) Aristolochene synthase

SCOPe Domain Sequences for d4kvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kvia_ a.128.1.4 (A:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl
rysv

SCOPe Domain Coordinates for d4kvia_:

Click to download the PDB-style file with coordinates for d4kvia_.
(The format of our PDB-style files is described here.)

Timeline for d4kvia_: