Lineage for d1tupb_ (1tup B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552786Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 552787Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins)
  6. 552788Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 552789Species Human (Homo sapiens) [TaxId:9606] [49420] (6 PDB entries)
  8. 552793Domain d1tupb_: 1tup B: [22435]

Details for d1tupb_

PDB Entry: 1tup (more details), 2.2 Å

PDB Description: tumor suppressor p53 complexed with dna

SCOP Domain Sequences for d1tupb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tupb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens)}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOP Domain Coordinates for d1tupb_:

Click to download the PDB-style file with coordinates for d1tupb_.
(The format of our PDB-style files is described here.)

Timeline for d1tupb_: