SCOPe 2.03: Domain d4kemb1: 4kem B:1-141

Lineage for d4kemb1 (4kem B:1-141)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Azospirillum sp. [TaxId:137722] [226670] (1 PDB entry)

8. Domain d4kemb1: 4kem B:1-141 [224271]
   Other proteins in same PDB: d4kema2, d4kemb2
   automated match to d1tzza2
   complexed with akr, cl, mg

Details for d4kemb1

PDB Entry: 4kem, 1.3 Å

PDB Description: Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4kemb1:

Sequence; same for both SEQRES and ATOM records:

>d4kemb1 d.54.1.0 (B:1-141) automated matches {Azospirillum sp. [TaxId: 137722]}
mriveireqtagiksdianafidfsqmtcsvvavvtdvvrdgkpvigygfnsngryaagg
llrerfiprlmsaapdslldetgenldpfriwtrlmtnekpgghgersvavgtidmavwd
avakiagvplyrlladrfrgg

Timeline for d4kemb1:

• d4kemb1 is new in SCOPe 2.03-stable
  
• d4kemb1 appears in SCOPe 2.04
  
• d4kemb1 appears in the current release, SCOPe 2.08