Lineage for d1tzza2 (1tzz A:1006-1145)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
C-terminal domain is beta/alpha-barrel
Protein Hypothetical protein Bll6730 [117927] (1 species) Species Bradyrhizobium japonicum [TaxId:375] [117928] (3 PDB entries)
Uniprot Q89FH0
Domain d1tzza2: 1tzz A:1006-1145 [112897]
Other proteins in same PDB: d1tzza1, d1tzzb1
Structural genomics target
complexed with mg
Details for d1tzza2
PDB Entry: 1tzz (more details), 1.86 Å
PDB Description: crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum
PDB Compounds: (A:) Hypothetical protein L1841SCOPe Domain Sequences for d1tzza2:
Sequence, based on SEQRES records: (download)
>d1tzza2 d.54.1.1 (A:1006-1145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
vrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqgg
lirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwd
avakiagkplfrllaerhgv
Sequence, based on observed residues (ATOM records): (download)
>d1tzza2 d.54.1.1 (A:1006-1145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
vrivdvreitkpisstkmttslvavvtdvvregkrvvgygfnsngrygqgglirerfasr
ileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwdavakiagkp
lfrllaerhgv
SCOPe Domain Coordinates for d1tzza2:
Click to download the PDB-style file with coordinates for d1tzza2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tzza2:
- d1tzza2 first appeared in SCOP 1.71
- d1tzza2 appears in SCOPe 2.02
- d1tzza2 appears in SCOPe 2.04
- d1tzza2 appears in the current release, SCOPe 2.08
View in 3D
