| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (59 species) not a true protein |
| Species Azospirillum sp. [TaxId:137722] [226671] (1 PDB entry) |
| Domain d4kema2: 4kem A:142-390 [224270] Other proteins in same PDB: d4kema1, d4kemb1 automated match to d1tzza1 complexed with akr, cl, mg |
PDB Entry: 4kem (more details), 1.3 Å
SCOPe Domain Sequences for d4kema2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kema2 c.1.11.0 (A:142-390) automated matches {Azospirillum sp. [TaxId: 137722]}
vaddgvwvyaaggyyypgkdvkalqdemrsyrdrgyrvvkmkiggaplaedlrridavle
vvgsgdnlcvdangrfdidtaiaygealkpyglfwyeeagdpldyalqaelakhydrpma
tgenlfshqdarnlirhggmrpdrdwlqfdcalsyglveylrtldmlkengwssrrvvph
gghqmslniaaglhlggnesypdvfkpfcgfadgiavedgrvrlpdlpgvgfeakselfa
tmsgllgtr
Timeline for d4kema2: