SCOPe 2.06: Domain d4kedb_: 4ked B:

Lineage for d4kedb_ (4ked B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein automated matches [190045] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197113] (3 PDB entries)

8. Domain d4kedb_: 4ked B: [224268]
   automated match to d4keea_
   mutant

Details for d4kedb_

PDB Entry: 4ked, 1.9 Å

PDB Description: Crystal Structure of Cofilin Mutant (cof1-157p)

PDB Compounds: (B:) cofilin

SCOPe Domain Sequences for d4kedb_:

Sequence, based on SEQRES records:

>d4kedb_ d.109.1.2 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
evsydsvledvsrg

Sequence, based on observed residues (ATOM records):

>d4kedb_ d.109.1.2 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
iydfeyeingkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfsevs
ydsvledvsrg

Timeline for d4kedb_:

• d4kedb_ first appeared in SCOPe 2.03
  
• d4kedb_ appears in SCOPe 2.05
  
• d4kedb_ appears in SCOPe 2.07
  
• d4kedb_ appears in the current release, SCOPe 2.08