| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (165 species) not a true protein |
| Species Anaeromyxobacter dehalogenans [TaxId:455488] [226576] (3 PDB entries) |
| Domain d4kdya1: 4kdy A:1-85 [224256] Other proteins in same PDB: d4kdya2, d4kdya3, d4kdyb2, d4kdyb3 automated match to d1e6ba2 complexed with cit, gol, gsh |
PDB Entry: 4kdy (more details), 1.5 Å
SCOPe Domain Sequences for d4kdya1:
Sequence, based on SEQRES records: (download)
>d4kdya1 c.47.1.0 (A:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnpmsqvpvleve
edgrthllvqsmailewleerhpep
>d4kdya1 c.47.1.0 (A:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahmsqvpvleveedgrt
hllvqsmailewleerhpep
Timeline for d4kdya1: