Lineage for d4kaha_ (4kah A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2512071Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2512072Protein automated matches [190117] (50 species)
    not a true protein
  7. 2512284Species Rhizobium etli [TaxId:347834] [226336] (19 PDB entries)
  8. 2512315Domain d4kaha_: 4kah A: [224241]
    automated match to d1lioa_
    complexed with adn, br, byz, dms, k

Details for d4kaha_

PDB Entry: 4kah (more details), 1.8 Å

PDB Description: Crystal structure of probable sugar kinase protein from Rhizobium etli CFN 42 complexed with 4-bromo-1H-pyrazole
PDB Compounds: (A:) Probable sugar kinase protein

SCOPe Domain Sequences for d4kaha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kaha_ c.72.1.0 (A:) automated matches {Rhizobium etli [TaxId: 347834]}
mtrfdvltvgnaivdiisrcndqflidnqitkaamnlidaeraellysrmgpaleasggs
agntaagvanlggkaayfgnvaadqlgdifthdiraqgvhyqtkpkgafpptarsmifvt
edgersmntylgacvelgpedveadvvadakvtyfegylwdpprakeaildcariahqhg
remsmtlsdsfcvdryrgefldlmrsgkvdivfanrqealslyqtddfeealnriaadck
iaavtmsengavilkgreryyvnairirevvdttgagdlfasgflygytqgrsledcgkl
gclaagiviqqigprpmtslseaakqagli

SCOPe Domain Coordinates for d4kaha_:

Click to download the PDB-style file with coordinates for d4kaha_.
(The format of our PDB-style files is described here.)

Timeline for d4kaha_: