Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [226972] (9 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:69014] [226699] (1 PDB entry) |
Domain d4k8za2: 4k8z A:348-756 [224215] Other proteins in same PDB: d4k8za1 automated match to d1qqca2 protein/DNA complex; complexed with edo, mg, nco |
PDB Entry: 4k8z (more details), 2.29 Å
SCOPe Domain Sequences for d4k8za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k8za2 e.8.1.1 (A:348-756) automated matches {Thermococcus kodakarensis [TaxId: 69014]} stgnlvewfllrkayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrs lypsiiithnvspdtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkm katidpierklldyrqraikilansyygyygyararwyckecaesvtawgreyitmtike ieekygfkviysdtdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgf fvtkkkyavideegkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevt eklskyevppeklviheqitrdlkdykatgphvavakrlaargvkirpgtvisyivlkgs grigdraipfdefdptkhkydaeyyienqvlpaverilrafgyrkedlr
Timeline for d4k8za2: