Lineage for d4k8za2 (4k8z A:348-756)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016762Protein automated matches [226972] (9 species)
    not a true protein
  7. 3016814Species Thermococcus kodakarensis [TaxId:69014] [226699] (1 PDB entry)
  8. 3016815Domain d4k8za2: 4k8z A:348-756 [224215]
    Other proteins in same PDB: d4k8za1
    automated match to d1qqca2
    protein/DNA complex; complexed with edo, mg, nco

Details for d4k8za2

PDB Entry: 4k8z (more details), 2.29 Å

PDB Description: kod polymerase in binary complex with dsdna
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4k8za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8za2 e.8.1.1 (A:348-756) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
stgnlvewfllrkayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkm
katidpierklldyrqraikilansyygyygyararwyckecaesvtawgreyitmtike
ieekygfkviysdtdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgf
fvtkkkyavideegkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevt
eklskyevppeklviheqitrdlkdykatgphvavakrlaargvkirpgtvisyivlkgs
grigdraipfdefdptkhkydaeyyienqvlpaverilrafgyrkedlr

SCOPe Domain Coordinates for d4k8za2:

Click to download the PDB-style file with coordinates for d4k8za2.
(The format of our PDB-style files is described here.)

Timeline for d4k8za2: