Lineage for d4k8za1 (4k8z A:1-347)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2125095Species Thermococcus kodakarensis [TaxId:69014] [226698] (1 PDB entry)
  8. 2125096Domain d4k8za1: 4k8z A:1-347 [224214]
    Other proteins in same PDB: d4k8za2
    automated match to d1qqca1
    protein/DNA complex; complexed with edo, mg, nco

Details for d4k8za1

PDB Entry: 4k8z (more details), 2.29 Å

PDB Description: kod polymerase in binary complex with dsdna
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4k8za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8za1 c.55.3.0 (A:1-347) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafaiatlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

SCOPe Domain Coordinates for d4k8za1:

Click to download the PDB-style file with coordinates for d4k8za1.
(The format of our PDB-style files is described here.)

Timeline for d4k8za1: