Lineage for d1qunj1 (1qun J:1-158)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368306Superfamily b.2.3: Bacterial adhesins [49401] (5 families) (S)
  5. 368311Family b.2.3.2: Pilus subunits [49405] (4 proteins)
  6. 368317Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 368318Species Escherichia coli [TaxId:562] [49407] (3 PDB entries)
  8. 368343Domain d1qunj1: 1qun J:1-158 [22419]
    Other proteins in same PDB: d1quna1, d1quna2, d1qunc1, d1qunc2, d1qune1, d1qune2, d1qung1, d1qung2, d1quni1, d1quni2, d1qunk1, d1qunk2, d1qunm1, d1qunm2, d1quno1, d1quno2

Details for d1qunj1

PDB Entry: 1qun (more details), 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli

SCOP Domain Sequences for d1qunj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qunj1 b.2.3.2 (J:1-158) Mannose-specific adhesin FimH {Escherichia coli}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOP Domain Coordinates for d1qunj1:

Click to download the PDB-style file with coordinates for d1qunj1.
(The format of our PDB-style files is described here.)

Timeline for d1qunj1: