SCOP 1.55: Domain d1qunj1: 1qun J:1-158

Lineage for d1qunj1 (1qun J:1-158)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.3: Bacterial adhesins [49401] (2 families)

5. Family b.2.3.2: Pilus subunits [49405] (2 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)

7. Species Escherichia coli [TaxId:562] [49407] (1 PDB entry)

8. Domain d1qunj1: 1qun J:1-158 [22419]
   Other proteins in same PDB: d1quna1, d1quna2, d1qunc1, d1qunc2, d1qune1, d1qune2, d1qung1, d1qung2, d1quni1, d1quni2, d1qunk1, d1qunk2, d1qunm1, d1qunm2, d1quno1, d1quno2

Details for d1qunj1

PDB Entry: 1qun, 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli

SCOP Domain Sequences for d1qunj1:

Sequence; same for both SEQRES and ATOM records:

>d1qunj1 b.2.3.2 (J:1-158) Mannose-specific adhesin FimH {Escherichia coli}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d1qunj1:

• d1qunj1 appears in SCOP 1.57
  
• d1qunj1 appears in the current release, SCOPe 2.08