SCOPe 2.06: Domain d4k6fc_: 4k6f C:

Lineage for d4k6fc_ (4k6f C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries)

8. Domain d4k6fc_: 4k6f C: [224182]
   automated match to d4k6cb_
   complexed with nap

Details for d4k6fc_

PDB Entry: 4k6f, 1.5 Å

PDB Description: X-ray crystal structure of a putative Acetoacetyl-CoA reductase from Burkholderia cenocepacia bound to the co-factor NADP

PDB Compounds: (C:) Putative Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d4k6fc_:

Sequence; same for both SEQRES and ATOM records:

>d4k6fc_ c.2.1.0 (C:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
kriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaagrefhaypvdv
adhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtnldsvfnmtkp
vcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleiarkgvtvntvs
pgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagfvtgsniaing
gqhmh

Timeline for d4k6fc_:

• d4k6fc_ first appeared in SCOPe 2.03
  
• d4k6fc_ appears in SCOPe 2.05
  
• d4k6fc_ appears in SCOPe 2.07
  
• d4k6fc_ appears in the current release, SCOPe 2.08