SCOPe 2.07: Domain d4k2ua_: 4k2u A:

Lineage for d4k2ua_ (4k2u A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
   consist of two subdomains, each containing a three-helical bundle

4. Superfamily a.264.1: Duffy binding domain-like [140924] (2 families)
   automatically mapped to Pfam PF05424

5. Family a.264.1.0: automated matches [227296] (1 protein)
   not a true family

6. Protein automated matches [227121] (1 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [226689] (1 PDB entry)

8. Domain d4k2ua_: 4k2u A: [224119]
   Other proteins in same PDB: d4k2ul1, d4k2ul2, d4k2um1, d4k2um2
   automated match to d2c6ja1
   complexed with so4

Details for d4k2ua_

PDB Entry: 4k2u, 2.45 Å

PDB Description: crystal structure of pfeba-175 f1 in complex with r218 antibody fab fragment

PDB Compounds: (A:) Erythrocyte binding antigen 175

SCOPe Domain Sequences for d4k2ua_:

Sequence, based on SEQRES records:

>d4k2ua_ a.264.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
vlsncrekrkgmkwdckkkndrsnyvcipdrriqlcivnlsiiktytketmkdhfieask
kesqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenkiqevfkgahg
eisehkiknfrkkwwnefreklweamlsehknninncknipqeelqitqwikewhgefll
erdnrsklpkskcknntlyeacekecidpcmkyrdwiirskfewhtlskeyetqkvpken
aenylikisenkndakvslllnncdaeyskyc

Sequence, based on observed residues (ATOM records):

>d4k2ua_ a.264.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
vlsncrekrkgmkwdckkkndnyvcipdrriqlcivnlsiiktytketmkdhfieaskke
sqlllkkndnkynskfcndlknsfldyghlamgndmdfggystkaenkiqevfkgahhki
knfrkkwwnefreklweamlsehknninncknipqeelqitqwikewhgefllerdnrsk
lkecidpcmkyrdwiirskfewhtlskeyetqkkvslllnncdaeyskyc

Timeline for d4k2ua_:

• d4k2ua_ first appeared in SCOPe 2.03
  
• d4k2ua_ appears in SCOPe 2.06
  
• d4k2ua_ appears in the current release, SCOPe 2.08