Lineage for d4k0ra1 (4k0r A:3-205)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106750Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2106751Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2106752Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 protein domains)
  6. 2106753Protein Cryptochrome [82367] (3 species)
  7. 2106754Species Mouse (Mus musculus) [TaxId:10090] [226829] (2 PDB entries)
  8. 2106755Domain d4k0ra1: 4k0r A:3-205 [224097]
    Other proteins in same PDB: d4k0ra2
    automated match to d1qnfa2

Details for d4k0ra1

PDB Entry: 4k0r (more details), 2.65 Å

PDB Description: Crystal structure of mouse Cryptochrome 1
PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d4k0ra1:

Sequence, based on SEQRES records: (download)

>d4k0ra1 c.28.1.1 (A:3-205) Cryptochrome {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcledl
danlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagv
evivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtpl
sddhdekygvpsleelgfdtdgl

Sequence, based on observed residues (ATOM records): (download)

>d4k0ra1 c.28.1.1 (A:3-205) Cryptochrome {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyildpvginrwrfllqcledldanlrkl
nsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagvevivris
htlydldkiielnggqppltykrfqtlvskmeplempcmtplsddhdekygvpsleelgf
dtl

SCOPe Domain Coordinates for d4k0ra1:

Click to download the PDB-style file with coordinates for d4k0ra1.
(The format of our PDB-style files is described here.)

Timeline for d4k0ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k0ra2