Lineage for d4k0ra2 (4k0r A:206-489)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003513Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2003514Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2003515Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 protein domains)
  6. 2003537Protein Cryptochrome C-terminal domain [81841] (3 species)
  7. 2003538Species Mouse (Mus musculus) [TaxId:10090] [226830] (2 PDB entries)
  8. 2003539Domain d4k0ra2: 4k0r A:206-489 [224098]
    Other proteins in same PDB: d4k0ra1
    automated match to d1owla1

Details for d4k0ra2

PDB Entry: 4k0r (more details), 2.65 Å

PDB Description: Crystal structure of mouse Cryptochrome 1
PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d4k0ra2:

Sequence, based on SEQRES records: (download)

>d4k0ra2 a.99.1.1 (A:206-489) Cryptochrome C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanferprmnansllasptglspylrfgclscrlf
yfkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpe
alakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeell
ldadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiy
dpwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyq

Sequence, based on observed residues (ATOM records): (download)

>d4k0ra2 a.99.1.1 (A:206-489) Cryptochrome C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanferprsllasptglspylrfgclscrlfyfkl
tdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpealak
waegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeellldad
wsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiydpwn
apegiqkvakcligvnypkpmvnhaeasrlniermkqiyq

SCOPe Domain Coordinates for d4k0ra2:

Click to download the PDB-style file with coordinates for d4k0ra2.
(The format of our PDB-style files is described here.)

Timeline for d4k0ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k0ra1