Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:279238] [226680] (3 PDB entries) |
Domain d4jwvb_: 4jwv B: [224050] Other proteins in same PDB: d4jwva2 automated match to d3tlfd_ |
PDB Entry: 4jwv (more details), 2.1 Å
SCOPe Domain Sequences for d4jwvb_:
Sequence, based on SEQRES records: (download)
>d4jwvb_ c.14.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} adidfrieghvahvrlnrpqglnaitqemddllldawtevnansdiwavvlsaegekafc igadvsggaerktrmalgggltgiggplvtckkpmvaavqgfcvgggfelamcadiivaa dtaqfglpetkvgiigecgvvhramrqlpyhialqliltgerikadearhyglvnevvpf aeleeaalrwasklnaasplavqaakaaalgrlghplevalmtrfepieeyaatedkkeg eraagerrkpvwtgk
>d4jwvb_ c.14.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} adidfrieghvahvrlnrpqglnaitqemddllldawtevnansdiwavvlsaegekafc igadvaerktrmalgggltgiggplvtckkpmvaavqgfcvgggfelamcadiivaadta qfglpetkvgiigecgvvhramrqlpyhialqliltgerikadearhyglvnevvpfael eeaalrwasklnaasplavqaakaaalgrlghplevalmtrfepieeyaatedkkegera agerrkpvwtgk
Timeline for d4jwvb_: