Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein automated matches [190083] (10 species) not a true protein |
Species Neisseria meningitidis [TaxId:122586] [189819] (16 PDB entries) |
Domain d4jtid_: 4jti D: [224011] automated match to d3unda_ complexed with cl; mutant |
PDB Entry: 4jti (more details), 1.75 Å
SCOPe Domain Sequences for d4jtid_:
Sequence, based on SEQRES records: (download)
>d4jtid_ c.1.10.4 (D:) automated matches {Neisseria meningitidis [TaxId: 122586]} mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkanr ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlparlaqqtd lvvamaktgnvvnikkpqglspsqmknivekfheagngklilcergssfgydnlvvdmlg fgvmkqtcgnlpvifdvthslqtrdagsaasggrraqaldlalagmatrlaglfleshpd pklakcdgpsalplhlledflirikalddliksqpil
>d4jtid_ c.1.10.4 (D:) automated matches {Neisseria meningitidis [TaxId: 122586]} mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkanr ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlparlaqqtd lvvamaktgnvvnikkpqglspsqmknivekfheagngklilcergssfgydnlvvdmlg fgvmkqtcgnlpvifdvthslqtrgrraqaldlalagmatrlaglfleshpalplhlled flirikalddliksqpil
Timeline for d4jtid_: