SCOPe 2.08: Domain d4jq6c_: 4jq6 C:

Lineage for d4jq6c_ (4jq6 C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (25 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [226659] (1 PDB entry)

8. Domain d4jq6c_: 4jq6 C: [223938]
   automated match to d1brxa_
   complexed with li1, ret

Details for d4jq6c_

PDB Entry: 4jq6, 2.31 Å

PDB Description: Crystal structure of blue light-absorbing proteorhodopsin from Med12 at 2.3 Angstrom

PDB Compounds: (C:) Proteorhodopsin

SCOPe Domain Sequences for d4jq6c_:

Sequence, based on SEQRES records:

>d4jq6c_ f.13.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
dyvgisfwlaaaimlastvfffversdvpvkwktsltvaglvtgvafwhylymrgvwiya
getptvfryidwlitvplqiiefyliiaavtaissavfwklliaslvmliggfigeaglg
dvvvwwivgmiawlyiiyeiflgetakanagsgnaasqqafntikwivtvgwaiypigya
wgyfgdglnedalnivynladlinkaafglaiwaaamkdket

Sequence, based on observed residues (ATOM records):

>d4jq6c_ f.13.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
dyvgisfwlaaaimlastvfffversdvpvkwktsltvaglvtgvafwhylymrgvwiya
getptvfryidwlitvplqiiefyliiavfwklliaslvmliggfigeaglgdvvvwwiv
gmiawlyiiyeifsqqafntikwivtvgwaiypigyawgyfgdglnedalnivynladli
nkaafglaiwaaamkdket

Timeline for d4jq6c_:

• d4jq6c_ first appeared in SCOPe 2.03
  
• d4jq6c_ appears in SCOPe 2.07