SCOPe 2.08: Domain d4jo5a_: 4jo5 A:

Lineage for d4jo5a_ (4jo5 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein automated matches [190248] (6 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1094188] [224858] (1 PDB entry)

8. Domain d4jo5a_: 4jo5 A: [223923]
   automated match to d1nbca_
   complexed with 1mz, ca, cl, gol, so4

Details for d4jo5a_

PDB Entry: 4jo5, 1.98 Å

PDB Description: CBM3a-L domain with flanking linkers from scaffoldin cipA of cellulosome of Clostridium thermocellum

PDB Compounds: (A:) Cellulosome anchoring protein cohesin region

SCOPe Domain Sequences for d4jo5a_:

Sequence; same for both SEQRES and ATOM records:

>d4jo5a_ b.2.2.2 (A:) automated matches {Clostridium thermocellum [TaxId: 1094188]}
ntpvsgnlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfw
cdhaaiigsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfa
kndwsnytqsndysfksasqfvewdqvtaylngvlvwgkepggsvvpstq

Timeline for d4jo5a_:

• d4jo5a_ first appeared in SCOPe 2.03
  
• d4jo5a_ appears in SCOPe 2.07