| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
| Protein automated matches [190248] (6 species) not a true protein |
| Species Clostridium thermocellum [TaxId:1094188] [224858] (1 PDB entry) |
| Domain d4jo5a_: 4jo5 A: [223923] automated match to d1nbca_ complexed with 1mz, ca, cl, gol, so4 |
PDB Entry: 4jo5 (more details), 1.98 Å
SCOPe Domain Sequences for d4jo5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jo5a_ b.2.2.2 (A:) automated matches {Clostridium thermocellum [TaxId: 1094188]}
ntpvsgnlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfw
cdhaaiigsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfa
kndwsnytqsndysfksasqfvewdqvtaylngvlvwgkepggsvvpstq
Timeline for d4jo5a_: