Lineage for d4jnfa2 (4jnf A:507-604)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697230Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) (S)
  5. 2697231Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 2697246Protein automated matches [227118] (3 species)
    not a true protein
  7. 2697247Species Escherichia coli K-12 [TaxId:83333] [226639] (2 PDB entries)
  8. 2697250Domain d4jnfa2: 4jnf A:507-604 [223910]
    Other proteins in same PDB: d4jnfa1, d4jnfa3
    automated match to d1dkya1

Details for d4jnfa2

PDB Entry: 4jnf (more details), 1.62 Å

PDB Description: allosteric opening of the polypeptide-binding site when an hsp70 binds atp
PDB Compounds: (A:) Hsp70 CHAPERONE DnaK

SCOPe Domain Sequences for d4jnfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jnfa2 a.8.4.1 (A:507-604) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklmeiaqq

SCOPe Domain Coordinates for d4jnfa2:

Click to download the PDB-style file with coordinates for d4jnfa2.
(The format of our PDB-style files is described here.)

Timeline for d4jnfa2: