SCOPe 2.04: Domain d4jn6c2: 4jn6 C:289-342

Lineage for d4jn6c2 (4jn6 C:289-342)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.7: post-HMGL domain-like [89000] (3 families)

5. Family a.5.7.0: automated matches [227294] (1 protein)
   not a true family

6. Protein automated matches [227119] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [226658] (1 PDB entry)

8. Domain d4jn6c2: 4jn6 C:289-342 [223908]
   Other proteins in same PDB: d4jn6a1, d4jn6c1
   automated match to d1nvmc1
   complexed with mn, na, oxl

Details for d4jn6c2

PDB Entry: 4jn6, 1.93 Å

PDB Description: Crystal Structure of the Aldolase-Dehydrogenase Complex from Mycobacterium tuberculosis HRv37

PDB Compounds: (C:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4jn6c2:

Sequence; same for both SEQRES and ATOM records:

>d4jn6c2 a.5.7.0 (C:289-342) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
yssflkhavrqaerygvpasallhragqrkliggqedqlidialeikreldsga

Timeline for d4jn6c2:

• d4jn6c2 first appeared in SCOPe 2.03
  
• d4jn6c2 appears in SCOPe 2.05
  
• d4jn6c2 appears in the current release, SCOPe 2.08