Class a: All alpha proteins [46456] (285 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) |
Family a.5.7.0: automated matches [227294] (1 protein) not a true family |
Protein automated matches [227119] (2 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [226658] (1 PDB entry) |
Domain d4jn6c2: 4jn6 C:289-342 [223908] Other proteins in same PDB: d4jn6a1, d4jn6c1 automated match to d1nvmc1 complexed with mn, na, oxl |
PDB Entry: 4jn6 (more details), 1.93 Å
SCOPe Domain Sequences for d4jn6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jn6c2 a.5.7.0 (C:289-342) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} yssflkhavrqaerygvpasallhragqrkliggqedqlidialeikreldsga
Timeline for d4jn6c2: