Lineage for d4jgaa2 (4jga A:267-428)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1393110Species Rickettsia rickettsii [TaxId:392021] [226679] (1 PDB entry)
  8. 1393112Domain d4jgaa2: 4jga A:267-428 [223807]
    automated match to d1ox0a2
    complexed with edo, k, na

Details for d4jgaa2

PDB Entry: 4jga (more details), 2.1 Å

PDB Description: X-ray crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase 2 from Rickettsia rickettsii
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4jgaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jgaa2 c.95.1.0 (A:267-428) automated matches {Rickettsia rickettsii [TaxId: 392021]}
kvygevigygstgdayhmtaphpegrgayramrdamldatitpdmidyinahgtsttlgd
gielaavqklfleanpkvlmsstkssighllgaagsvefifsalairdqiapptlnldtp
mdevnidlvalkakktkidyvlsnsfgfggtnaslviksilv

SCOPe Domain Coordinates for d4jgaa2:

Click to download the PDB-style file with coordinates for d4jgaa2.
(The format of our PDB-style files is described here.)

Timeline for d4jgaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jgaa1