Lineage for d1ox0a2 (1ox0 A:252-409)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the restSuperfamily c.95.1: Thiolase-like [53901] (3 families) 
Family c.95.1.1: Thiolase-related [53902] (9 proteins) Protein Beta-ketoacyl-ACP synthase II [53909] (6 species) Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89793] (4 PDB entries) 
Domain d1ox0a2: 1ox0 A:252-409 [87496]
complexed with mg
Details for d1ox0a2
PDB Entry: 1ox0 (more details), 1.3 Å
PDB Description: the crystal structure of beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae
PDB Compounds: (A:) Beta ketoacyl-acyl carrier protein synthaseSCOPe Domain Sequences for d1ox0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvnahgtstpane
kgesgaivavlgkevpvsstksftghllgaagaveaivtieamrhnfvpmtagtsevsdy
ieanvvygqglekeipyaisntfgfgghnavlafkrwe
SCOPe Domain Coordinates for d1ox0a2:
Click to download the PDB-style file with coordinates for d1ox0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ox0a2:
- d1ox0a2 first appeared in SCOP 1.65
- d1ox0a2 appears in SCOPe 2.02
- d1ox0a2 appears in SCOPe 2.04
- d1ox0a2 appears in the current release, SCOPe 2.08
View in 3D
