Lineage for d4jd1a1 (4jd1 A:1-139)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2549949Species Bacillus anthracis [TaxId:198094] [226573] (4 PDB entries)
  8. 2549952Domain d4jd1a1: 4jd1 A:1-139 [223743]
    Other proteins in same PDB: d4jd1a2, d4jd1b2, d4jd1b3
    automated match to d1npbc_
    complexed with fcn, pge, zn

Details for d4jd1a1

PDB Entry: 4jd1 (more details), 1.7 Å

PDB Description: Crystal Structure of Metallothiol Transferase FosB 2 from Bacillus anthracis str. Ames
PDB Compounds: (A:) Metallothiol transferase fosB 2

SCOPe Domain Sequences for d4jd1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jd1a1 d.32.1.0 (A:1-139) automated matches {Bacillus anthracis [TaxId: 198094]}
mlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprnei
kqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgt
lqnrleyykedkkhmtfyi

SCOPe Domain Coordinates for d4jd1a1:

Click to download the PDB-style file with coordinates for d4jd1a1.
(The format of our PDB-style files is described here.)

Timeline for d4jd1a1: