Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [226688] (2 PDB entries) |
Domain d4jcqp_: 4jcq P: [223718] automated match to d3q7ha_ |
PDB Entry: 4jcq (more details), 2 Å
SCOPe Domain Sequences for d4jcqp_:
Sequence, based on SEQRES records: (download)
>d4jcqp_ c.14.1.0 (P:) automated matches {Listeria monocytogenes [TaxId: 169963]} iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvqgqsteieie akeiirmrerinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
>d4jcqp_ c.14.1.0 (P:) automated matches {Listeria monocytogenes [TaxId: 169963]} iltqklidtrtvliygeinqelaedvskqllllesisndpitifinsqgghveagdtihd mikfikptvkvvgtgwvasagitiylaaekenrfslpntrymihqpaggvieakeiirmr erinrliaeatgqsyeqiskdtdrnfwlsvneakdygivneiienrdglk
Timeline for d4jcqp_: