SCOPe 2.06: Domain d1dqkb_: 1dqk B:

Lineage for d1dqkb_ (1dqk B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein Superoxide reductase (SOR) [49369] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [49370] (3 PDB entries)

8. Domain d1dqkb_: 1dqk B: [22364]
   complexed with fe2

Details for d1dqkb_

PDB Entry: 1dqk, 2 Å

PDB Description: crystal structure of superoxide reductase in the reduced state at 2.0 angstroms resolution

PDB Compounds: (B:) superoxide reductase

SCOPe Domain Sequences for d1dqkb_:

Sequence; same for both SEQRES and ATOM records:

>d1dqkb_ b.1.13.1 (B:) Superoxide reductase (SOR) {Pyrococcus furiosus [TaxId: 2261]}
misetirsgdwkgekhvpvieyeregelvkvkvqvgkeiphpnttehhiryielyflpeg
enfvyqvgrveftahgesvngpntsdvytepiayfvlktkkkgklyalsycnihglwene
vtle

Timeline for d1dqkb_:

• d1dqkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqkb_ appears in SCOPe 2.05
  
• d1dqkb_ appears in SCOPe 2.07
  
• d1dqkb_ appears in the current release, SCOPe 2.08