Lineage for d4j6xb_ (4j6x B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539467Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 1539468Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 1539476Species Pseudomonas aeruginosa [TaxId:287] [141293] (11 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 1539533Domain d4j6xb_: 4j6x B: [223605]
    automated match to d1u1te_
    protein/RNA complex; complexed with utp

Details for d4j6xb_

PDB Entry: 4j6x (more details), 2.22 Å

PDB Description: Crystal structure of Hfq from Pseudomonas aeruginosa in complex with UTP
PDB Compounds: (B:) Protein hfq

SCOPe Domain Sequences for d4j6xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j6xb_ b.38.1.2 (B:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
srpvrlp

SCOPe Domain Coordinates for d4j6xb_:

Click to download the PDB-style file with coordinates for d4j6xb_.
(The format of our PDB-style files is described here.)

Timeline for d4j6xb_: