SCOPe 2.08: Domain d4j15a1: 4j15 A:21-152

Lineage for d4j15a1 (4j15 A:21-152)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)

8. Domain d4j15a1: 4j15 A:21-152 [223509]
   Other proteins in same PDB: d4j15a2, d4j15b2
   automated match to d1asza1
   protein/RNA complex; complexed with gol

Details for d4j15a1

PDB Entry: 4j15, 2.24 Å

PDB Description: Crystal structure of human cytosolic aspartyl-tRNA synthetase, a component of multi-tRNA synthetase complex

PDB Compounds: (A:) Aspartate--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4j15a1:

Sequence; same for both SEQRES and ATOM records:

>d4j15a1 b.40.4.0 (A:21-152) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aedyakerygissmiqsqekpdrvlvrvrdltiqkadevvwvrarvhtsrakgkqcflvl
rqqqfnvqalvavgdhaskqmvkfaaninkesivdvegvvrkvnqkigsctqqdvelhvq
kiyvislaeprl

Timeline for d4j15a1:

• d4j15a1 first appeared in SCOPe 2.03
  
• d4j15a1 appears in SCOPe 2.07