SCOP 1.75: Domain d1kbpb1: 1kbp B:9-120

Lineage for d1kbpb1 (1kbp B:9-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family)

5. Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)

6. Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)

7. Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (5 PDB entries)

8. Domain d1kbpb1: 1kbp B:9-120 [22350]
   Other proteins in same PDB: d1kbpa2, d1kbpb2, d1kbpc2, d1kbpd2

Details for d1kbpb1

PDB Entry: 1kbp, 2.65 Å

PDB Description: kidney bean purple acid phosphatase

PDB Compounds: (B:) purple acid phosphatase

SCOP Domain Sequences for d1kbpb1:

Sequence; same for both SEQRES and ATOM records:

>d1kbpb1 b.1.12.1 (B:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d1kbpb1:

• d1kbpb1 first appeared (with stable ids) in SCOP 1.55
  
• d1kbpb1 appears in SCOP 1.73
  
• d1kbpb1 appears in SCOPe 2.01
  
• d1kbpb1 appears in the current release, SCOPe 2.08