SCOPe 2.04: Domain d4iz9a2: 4iz9 A:188-388

Lineage for d4iz9a2 (4iz9 A:188-388)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:243243] [226597] (1 PDB entry)

8. Domain d4iz9a2: 4iz9 A:188-388 [223485]
   automated match to d1g99a2
   complexed with apc, edo, mn, sin

Details for d4iz9a2

PDB Entry: 4iz9, 1.98 Å

PDB Description: crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese

PDB Compounds: (A:) acetate kinase

SCOPe Domain Sequences for d4iz9a2:

Sequence; same for both SEQRES and ATOM records:

>d4iz9a2 c.55.1.0 (A:188-388) automated matches {Mycobacterium avium [TaxId: 243243]}
plrglkqivlhlgngcsasaiagtrpldtsmgltpleglvmgtrsgdidpsvvsylchta
gmgvddvesmlnhrsgvvglsgvrdfrrlreliesgdgaaqlaysvfthrlrkyigayla
vlghtdvisftagigendaavrrdavsgmeelgivlderrnlpgakgarqisaddspitv
lvvptneelaiardcvrvlgg

Timeline for d4iz9a2:

• d4iz9a2 first appeared in SCOPe 2.03
  
• d4iz9a2 appears in SCOPe 2.05
  
• d4iz9a2 appears in the current release, SCOPe 2.08