SCOPe 2.06: Domain d4ixca1: 4ixc A:13-218

Lineage for d4ixca1 (4ixc A:13-218)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (58 PDB entries)

8. Domain d4ixca1: 4ixc A:13-218 [223457]
   automated match to d1bdga1
   complexed with 1jd, glc, na

Details for d4ixca1

PDB Entry: 4ixc, 2 Å

PDB Description: crystal structure of human glucokinase in complex with a small molecule activator.

PDB Compounds: (A:) Glucokinase isoform 3

SCOPe Domain Sequences for d4ixca1:

Sequence, based on SEQRES records:

>d4ixca1 c.55.1.0 (A:13-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsqveqilaefqlqaadlkkvmrrmqkemdrglrlethaaasvkmlptyvrstpegsevg
dflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisd
fldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrr
gdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records):

>d4ixca1 c.55.1.0 (A:13-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsqveqilaefqlqaadlkkvmrrmqkemdrglrlethaaasvkmlptyvrstpegsevg
dflsldlggtnfrvmlvkvgegqwsvktkhqmysipedamtgtaemlfdyisecisdfld
khqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgdf
emdvvamvndtvatmiscyyedh

Timeline for d4ixca1:

• d4ixca1 first appeared in SCOPe 2.03
  
• d4ixca1 appears in SCOPe 2.05
  
• d4ixca1 appears in SCOPe 2.07
  
• d4ixca1 appears in the current release, SCOPe 2.08