![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (42 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries) |
![]() | Domain d4ixca1: 4ixc A:13-218 [223457] automated match to d1bdga1 complexed with 1jd, glc, na |
PDB Entry: 4ixc (more details), 2 Å
SCOPe Domain Sequences for d4ixca1:
Sequence, based on SEQRES records: (download)
>d4ixca1 c.55.1.0 (A:13-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} nsqveqilaefqlqaadlkkvmrrmqkemdrglrlethaaasvkmlptyvrstpegsevg dflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisd fldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrr gdfemdvvamvndtvatmiscyyedh
>d4ixca1 c.55.1.0 (A:13-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} nsqveqilaefqlqaadlkkvmrrmqkemdrglrlethaaasvkmlptyvrstpegsevg dflsldlggtnfrvmlvkvgegqwsvktkhqmysipedamtgtaemlfdyisecisdfld khqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgdf emdvvamvndtvatmiscyyedh
Timeline for d4ixca1: