SCOPe 2.07: Domain d4iv5d2: 4iv5 D:158-327

Lineage for d4iv5d2 (4iv5 D:158-327)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226636] (7 PDB entries)

8. Domain d4iv5d2: 4iv5 D:158-327 [223412]
   automated match to d1ml4a2
   complexed with edo, po4, unx

Details for d4iv5d2

PDB Entry: 4iv5, 2.1 Å

PDB Description: X-ray crystal structure of a putative aspartate carbamoyltransferase from Trypanosoma cruzi

PDB Compounds: (D:) Aspartate carbamoyltransferase, putative

SCOPe Domain Sequences for d4iv5d2:

Sequence, based on SEQRES records:

>d4iv5d2 c.78.1.0 (D:158-327) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqkerfmastsddaaalqsfaakaditidaarmrl
akekmivmhplprndelsttvdadpraayfrqmrygmfmrmailwsvla

Sequence, based on observed residues (ATOM records):

>d4iv5d2 c.78.1.0 (D:158-327) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqkaditidaarmrlakekmivmhplprndelstt
vdadpraayfrqmrygmfmrmailwsvla

Timeline for d4iv5d2:

• d4iv5d2 first appeared in SCOPe 2.03
  
• d4iv5d2 appears in SCOPe 2.06
  
• d4iv5d2 appears in the current release, SCOPe 2.08