Lineage for d2mspe_ (2msp E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105897Superfamily b.1.11: PapD-like [49354] (2 families) (S)
  5. 105918Family b.1.11.2: Major sperm protein, alpha isoform (recombinant), ph 4.6 [49360] (1 protein)
  6. 105919Protein Major sperm protein, alpha isoform (recombinant), ph 4.6 [49361] (1 species)
  7. 105920Species Pig roundworm (Ascaris suum) [TaxId:6253] [49362] (3 PDB entries)
  8. 105927Domain d2mspe_: 2msp E: [22339]

Details for d2mspe_

PDB Entry: 2msp (more details), 3.3 Å

PDB Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5

SCOP Domain Sequences for d2mspe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mspe_ b.1.11.2 (E:) Major sperm protein, alpha isoform (recombinant), ph 4.6 {Pig roundworm (Ascaris suum)}
svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

SCOP Domain Coordinates for d2mspe_:

Click to download the PDB-style file with coordinates for d2mspe_.
(The format of our PDB-style files is described here.)

Timeline for d2mspe_: