Lineage for d4isea1 (4ise A:9-218)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606210Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries)
  8. 1606223Domain d4isea1: 4ise A:9-218 [223338]
    automated match to d1bdga1
    complexed with 1fw, glc, iod

Details for d4isea1

PDB Entry: 4ise (more details), 1.78 Å

PDB Description: human glucokinase in complex with novel activator (2s)-3-cyclohexyl-2- (6-fluoro-4-oxoquinazolin-3(4h)-yl)-n-(1,3-thiazol-2-yl)propanamide
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4isea1:

Sequence, based on SEQRES records: (download)

>d4isea1 c.55.1.0 (A:9-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpmpltlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpeg
sevgdflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyise
cisdfldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrda
ikrrgdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records): (download)

>d4isea1 c.55.1.0 (A:9-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpmpltlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpeg
sevgdflsldlggtnfrvmlvkvgegqwsvktkhqmysipedamtgtaemlfdyisecis
dfldkhqmkhkklplgftfsfpnnvvgllrdaikrrgdfemdvvamvndtvatmiscyye
dh

SCOPe Domain Coordinates for d4isea1:

Click to download the PDB-style file with coordinates for d4isea1.
(The format of our PDB-style files is described here.)

Timeline for d4isea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4isea2