Lineage for d4imrb_ (4imr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845874Species Agrobacterium fabrum [TaxId:176299] [226548] (2 PDB entries)
  8. 2845880Domain d4imrb_: 4imr B: [223258]
    Other proteins in same PDB: d4imra2
    automated match to d3awda_
    complexed with nap, unl

Details for d4imrb_

PDB Entry: 4imr (more details), 1.96 Å

PDB Description: crystal structure of 3-oxoacyl (acyl-carrier-protein) reductase (target efi-506442) from agrobacterium tumefaciens c58 with nadp bound
PDB Compounds: (B:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d4imrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4imrb_ c.2.1.0 (B:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
mrletifglrgrtalvtgssrgigaaiaeglagagahvilhgvkpgstaavqqriiasgg
taqelagdlseagagtdlieraeaiapvdilvinasaqinatlsaltpndlafqlavnlg
stvdmlqsalpkmvarkwgrvvsigsinqlrpksvvtayaatkaaqhnliqsqardfagd
nvllntlapglvdtdrnadrraqdpegwdeyvrtlnwmgragrpeemvgaalflaseacs
fmtgetifltggy

SCOPe Domain Coordinates for d4imrb_:

Click to download the PDB-style file with coordinates for d4imrb_.
(The format of our PDB-style files is described here.)

Timeline for d4imrb_: