SCOPe 2.04: Domain d4ijna1: 4ijn A:1-178

Lineage for d4ijna1 (4ijn A:1-178)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [226561] (1 PDB entry)

8. Domain d4ijna1: 4ijn A:1-178 [223227]
   automated match to d1g99a1
   complexed with amp, edo, so4

Details for d4ijna1

PDB Entry: 4ijn, 1.7 Å

PDB Description: crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate

PDB Compounds: (A:) acetate kinase

SCOPe Domain Sequences for d4ijna1:

Sequence; same for both SEQRES and ATOM records:

>d4ijna1 c.55.1.0 (A:1-178) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mvtvlvvnsgssslkyavvrpasgefladgiieeigsgavpdhdaalraafdelaaaglh
ledldlkavghrmvhggktfykpsvvddeliakarelsplaplhnppaikgievarkllp
dlphiavfdtaffhdlpapastyaidrelaetwhikrygfhgtsheyvsqqaaifldr

Timeline for d4ijna1:

• d4ijna1 first appeared in SCOPe 2.03
  
• d4ijna1 appears in SCOPe 2.05
  
• d4ijna1 appears in the current release, SCOPe 2.08