Lineage for d4ijha_ (4ijh A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541191Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1541383Protein automated matches [190206] (8 species)
    not a true protein
  7. 1541393Species Human (Homo sapiens) [TaxId:9606] [186959] (20 PDB entries)
  8. 1541397Domain d4ijha_: 4ijh A: [223221]
    automated match to d2b3ga_
    protein/DNA complex; complexed with 1ej

Details for d4ijha_

PDB Entry: 4ijh (more details), 1.5 Å

PDB Description: Fragment-based Discovery of Protein-Protein Interaction Inhibitors of Replication Protein A
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d4ijha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ijha_ b.40.4.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
yne

SCOPe Domain Coordinates for d4ijha_:

Click to download the PDB-style file with coordinates for d4ijha_.
(The format of our PDB-style files is described here.)

Timeline for d4ijha_: