![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
![]() | Protein automated matches [190206] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186959] (20 PDB entries) |
![]() | Domain d4ijha_: 4ijh A: [223221] automated match to d2b3ga_ protein/DNA complex; complexed with 1ej |
PDB Entry: 4ijh (more details), 1.5 Å
SCOPe Domain Sequences for d4ijha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijha_ b.40.4.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gshmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp yne
Timeline for d4ijha_: