SCOPe 2.02: Domain d1pdka1: 1pdk A:1-124

Lineage for d1pdka1 (1pdk A:1-124)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (5 proteins)

6. Protein Pilus chaperone PapD, N-domain [49356] (1 species)
   consists of two domains of this fold; domain 2 has an additional strand at the C-terminus

7. Species Escherichia coli [TaxId:562] [49357] (9 PDB entries)

8. Domain d1pdka1: 1pdk A:1-124 [22322]
   Other proteins in same PDB: d1pdka2, d1pdkb_

Details for d1pdka1

PDB Entry: 1pdk, 2.4 Å

PDB Description: papd-papk chaperone-pilus subunit complex from e.coli p pilus

PDB Compounds: (A:) protein (chaperone protein papd)

SCOPe Domain Sequences for d1pdka1:

Sequence; same for both SEQRES and ATOM records:

>d1pdka1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Timeline for d1pdka1:

• d1pdka1 first appeared (with stable ids) in SCOP 1.55
  
• d1pdka1 appears in SCOPe 2.01
  
• d1pdka1 appears in SCOPe 2.03
  
• d1pdka1 appears in the current release, SCOPe 2.08