Lineage for d4iiub_ (4iiu B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350415Species Escherichia coli [TaxId:199310] [226553] (3 PDB entries)
  8. 1350418Domain d4iiub_: 4iiu B: [223208]
    automated match to d2c07a1
    complexed with nap

Details for d4iiub_

PDB Entry: 4iiu (more details), 2.1 Å

PDB Description: crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.1 a resolution
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d4iiub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iiub_ c.2.1.0 (B:) automated matches {Escherichia coli [TaxId: 199310]}
srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
apglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisingg
ml

SCOPe Domain Coordinates for d4iiub_:

Click to download the PDB-style file with coordinates for d4iiub_.
(The format of our PDB-style files is described here.)

Timeline for d4iiub_: