![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (2 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains |
![]() | Protein Alpa-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49351] (8 PDB entries) |
![]() | Domain d1b9ka1: 1b9k A:702-824 [22315] Other proteins in same PDB: d1b9ka2 CASP3 |
PDB Entry: 1b9k (more details), 1.9 Å
SCOP Domain Sequences for d1b9ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9ka1 b.1.10.1 (A:702-824) Alpa-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus)} ednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnftptlicadd lqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqnvsvklpit lnk
Timeline for d1b9ka1: