Lineage for d1qtsa1 (1qts A:692-824)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291298Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (2 families) (S)
    contains an additional N-terminal strand
  5. 291299Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
    ear domain consists of two different subdomains
  6. 291300Protein Alpa-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)
  7. 291301Species Mouse (Mus musculus) [TaxId:10090] [49351] (8 PDB entries)
  8. 291303Domain d1qtsa1: 1qts A:692-824 [22313]
    Other proteins in same PDB: d1qtsa2

Details for d1qtsa1

PDB Entry: 1qts (more details), 1.4 Å

PDB Description: crystal structure of the ap-2 clathrin adaptor alpha-appendage

SCOP Domain Sequences for d1qtsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtsa1 b.1.10.1 (A:692-824) Alpa-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus)}
gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
qnvsvklpitlnk

SCOP Domain Coordinates for d1qtsa1:

Click to download the PDB-style file with coordinates for d1qtsa1.
(The format of our PDB-style files is described here.)

Timeline for d1qtsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qtsa2