Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) contains an additional N-terminal strand |
Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains automatically mapped to Pfam PF02883 |
Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries) Uniprot P17427 694-938 # 98% sequence identity |
Domain d1qtsa1: 1qts A:692-824 [22313] Other proteins in same PDB: d1qtsa2 |
PDB Entry: 1qts (more details), 1.4 Å
SCOPe Domain Sequences for d1qtsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtsa1 b.1.10.1 (A:692-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]} gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf qnvsvklpitlnk
Timeline for d1qtsa1: