Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (7 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (8 PDB entries) |
Domain d4i9uh2: 4i9u H:160-331 [223081] Other proteins in same PDB: d4i9ua1, d4i9ub1, d4i9uc1, d4i9ud1, d4i9ue1, d4i9uf1, d4i9ug1, d4i9uh1 automated match to d9ldta2 complexed with 1e7 |
PDB Entry: 4i9u (more details), 2.5 Å
SCOPe Domain Sequences for d4i9uh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i9uh2 d.162.1.1 (H:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf
Timeline for d4i9uh2: