SCOPe 2.02: Domain d1eqwd_: 1eqw D:

Lineage for d1eqwd_ (1eqw D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Salmonella typhimurium [TaxId:90371] [49339] (1 PDB entry)

8. Domain d1eqwd_: 1eqw D: [22297]
   complexed with cu, zn

Details for d1eqwd_

PDB Entry: 1eqw, 2.3 Å

PDB Description: crystal structure of salmonella typhimurium cu,zn superoxide dismutase

PDB Compounds: (D:) cu,zn superoxide dismutase

SCOPe Domain Sequences for d1eqwd_:

Sequence; same for both SEQRES and ATOM records:

>d1eqwd_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]}
ntltvkmndalssgtgenigeitvsetpygllftphlngltpgihgfhvhtnpscmpgmk
dgkevpalmagghldpektgkhlgpyndkghlgdlpglvvnadgtatypllaprlkslse
lkghslmihkggdnysdkpaplggggarfacgvi

Timeline for d1eqwd_:

• d1eqwd_ first appeared (with stable ids) in SCOP 1.55
  
• d1eqwd_ appears in SCOPe 2.01
  
• d1eqwd_ appears in SCOPe 2.03
  
• d1eqwd_ appears in the current release, SCOPe 2.08